DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk10

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001303594.1 Gene:Kcnk10 / 72258 MGIID:1919508 Length:538 Species:Mus musculus


Alignment Length:566 Identity:111/566 - (19%)
Similarity:188/566 - (33%) Gaps:214/566 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 EPKSL--GDQPLLPEESISEAKPKVTLWQRLKNLFRRKKKIQAKGEDVTDLSTELPLEKLASRGL 493
            :|||.  |..| :|..|||.   :.|:..|::.                           ||:| 
Mouse    29 QPKSATNGHHP-VPRLSISS---RATVVARMEG---------------------------ASQG- 61

  Fly   494 LYSFSLEARHEWKRLKLDYPQKVKELRQLRNRCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCE 558
                .|:...:||.:                  :|..:.:.:.|..|||:||..|...|:..|..
Mouse    62 ----GLQTVMKWKTV------------------VAIFVVVVVYLVTGGLVFRALEQPFESSQKNT 104

  Fly   559 VRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRSFEDELNNLAELGLRRYPGQKS-----WNFVN 618
            :...|.:|:            .|...::.|:|.:......:....|:... |..|     |:..:
Mouse   105 IALEKAEFL------------RDHICVSPQELETLIQHALDADNAGVSPV-GNSSNSSSHWDLGS 156

  Fly   619 CFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMY 683
            .|.|..|||||||||:|.|.|..|:...|:|||.|||:|..:||.:|                  
Mouse   157 AFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG------------------ 203

  Fly   684 YTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETP 748
                       .|:       .|::..:|.|....|        .:.|......|.:.|      
Mouse   204 -----------DQL-------GTIFGKSIARVEKVF--------RKKQVSQTKIRVIST------ 236

  Fly   749 TSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMME-------PSWTPLDAFYYVFISMST 806
                                     |.:||.|...|:.:.       ..||.|::.|:|.::::|
Mouse   237 -------------------------ILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTT 276

  Fly   807 IGFGDLVPS-------NPFYVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVGATIG--- 861
            :||||.|..       ..:|..:...:::.|||..:..::::    .|..::.|.|....:|   
Mouse   277 VGFGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMI----GDWLRVLSKKTKEEVGEIK 337

  Fly   862 -------MNMTSE-------LGDEGGSQVKTPSELASVHGSRL---------------------- 890
                   .|:|:|       |..|...:::..:.:.|:...||                      
Mouse   338 AHAAEWKANVTAEFRETRRRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAA 402

  Fly   891 ---DRIEEDGQEANGNGHSPVPPLTSILRAPRPLSPASNGVDANGV 933
               .|.:...||:..|     .|....|:.|..|:....|...:.:
Mouse   403 LDTGRFKASSQESINN-----RPNNLRLKGPEQLTKHGQGASEDNI 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 27/55 (49%)
Ion_trans_2 771..847 CDD:285168 20/89 (22%)
Kcnk10NP_001303594.1 Ion_trans_2 <152..206 CDD:369572 27/82 (33%)
Ion_trans_2 244..323 CDD:369572 17/82 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.