DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk5a

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001032478.1 Gene:kcnk5a / 570159 ZFINID:ZDB-GENE-051113-112 Length:513 Species:Danio rerio


Alignment Length:327 Identity:83/327 - (25%)
Similarity:128/327 - (39%) Gaps:107/327 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAML--LGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRS 592
            |:..|::  |..|..:|:..|   |..::..|||.:.|....|         :.:..|.:..|..
Zfish     7 LLTSAIIFYLSIGAAIFQVIE---EPNWEIAVRKYRADKESIL---------KQYPCLTKADLDY 59

  Fly   593 FEDELNNLAELGLRRYPGQK---SWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGI 654
            ..:.:::.|..|: ...|.|   :||:.|..||..|||||||||:|.|||..||...|.|.:.|:
Zfish    60 ILEVVSDAAGQGI-TITGDKTFNNWNWPNAVIFAATVITTIGYGNIAPKTPSGRVFCIFYGLFGV 123

  Fly   655 PMFLIVLADLGKLFTRCVKFL-WVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMF 718
            |:....:::|||.|....|.| |      |.|:....:||.|                       
Zfish   124 PLCFTWISELGKFFGGRAKHLGW------YLTKKGVTLRKTQ----------------------- 159

  Fly   719 FSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLL--LITYILLGS 781
                                                         |..:...||  ::.::::..
Zfish   160 ---------------------------------------------LTCTAVFLLWGVLIHLVIPP 179

  Fly   782 FGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV---------PSNPFYVMVSMIYLMFGLALTSMF 837
            |.|:..| .||.::..|:.|::::||||||||         |:...|.:...|||  |||..|:|
Zfish   180 FVFMTQE-GWTYIEGLYFSFVTLTTIGFGDLVAGVDPNAEYPTLYRYFVEVWIYL--GLAWLSLF 241

  Fly   838 IN 839
            .|
Zfish   242 FN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 28/55 (51%)
Ion_trans_2 771..847 CDD:285168 28/80 (35%)
kcnk5aNP_001032478.1 Ion_trans_2 <81..137 CDD:285168 27/55 (49%)
Ion_trans_2 171..243 CDD:285168 25/74 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.