DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk18

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001177236.2 Gene:kcnk18 / 561821 ZFINID:ZDB-GENE-100405-2 Length:391 Species:Danio rerio


Alignment Length:397 Identity:107/397 - (26%)
Similarity:169/397 - (42%) Gaps:100/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 VKELRQLRNRC-------------IAYLICMAMLLGFGGLLFR---YTEGAAENIYKCEVRKVKR 564
            |.:.||...||             |..|:..|:|   |.|:||   ||....|:.   |:..:  
Zfish     3 VSQKRQFTGRCSTLFWRLFPHVFLILSLVLYAVL---GALVFRAIEYTNPRNESE---EILSI-- 59

  Fly   565 DFIDRLWDVSHNMREEDWKSLARQKLRSFEDELNNLAELGLRRYPGQK----SWNFVNCFIFCWT 625
              :.::.::..|..:           .|.:..|.|.|:..|..|..:|    .|.|.....||.|
Zfish    60 --VQKVMEIVQNHTD-----------ASEQKHLINKAKYILDDYCYEKERDHGWTFFASLFFCCT 111

  Fly   626 VITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLG--------KLFTRCVKFLWVYVRRM 682
            |.||:|||.|.|.|..|:...::||::|||:.|:|::|:|        |.:||    |.::.||.
Zfish   112 VFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTR----LNLFFRRW 172

  Fly   683 YYTRSCR--RIRKQQQIRSAMTGFNTMYDM--------------------AIRRPSMFFSNSAPE 725
            ...:|.|  ...|...:..|....:..|..                    :|||.|....|    
Zfish   173 IGHQSWRLQSHEKTSALPQAQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRN---- 233

  Fly   726 NDE--ESQADAEAARSVGT-----SHPETPTSPYPETFEVDDEFN----------LPVSVASLLL 773
            |.|  :.....|:.|..||     |.||....|.|:    |:.||          :|:.|..|::
Zfish   234 NKEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPK----DELFNDIGQEMEQLDVPLLVILLMV 294

  Fly   774 ITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSMFI 838
            ..|:::.|......|......||||:.||:::||||||:||.:|.:.||:.::::.|:|:.||..
Zfish   295 FAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPEHPKFFMVTFLFIITGMAIMSMAF 359

  Fly   839 NVVQIKL 845
            .:.|.::
Zfish   360 KLGQSQI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 25/63 (40%)
Ion_trans_2 771..847 CDD:285168 26/75 (35%)
kcnk18NP_001177236.2 Ion_trans_2 <99..154 CDD:285168 24/54 (44%)
Ion_trans_2 292..367 CDD:285168 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590272
Domainoid 1 1.000 63 1.000 Domainoid score I10236
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm24931
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.