DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk1b

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001277277.1 Gene:kcnk1b / 561206 ZFINID:ZDB-GENE-090312-78 Length:337 Species:Danio rerio


Alignment Length:337 Identity:80/337 - (23%)
Similarity:130/337 - (38%) Gaps:112/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLR 591
            :.|||       ||.::|...|...|:..:.::|::||.|:            ::.:.|:.::|.
Zfish    31 VLYLI-------FGAVVFSSVELPYEDDLRQQLREIKRLFL------------QEHQCLSEERLE 76

  Fly   592 SFED---ELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIG 653
            .|..   |.:|.....|.......:|:|.:...|..||::|.||||..|.:..|::..|:|::||
Zfish    77 RFLSKALEASNYGVSILNNASASWNWDFTSSLFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIG 141

  Fly   654 IPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMF 718
            ||..|:.|       |..|:.:.||                                :..||.|:
Zfish   142 IPFTLLFL-------TAVVQRIMVY--------------------------------STWRPIMY 167

  Fly   719 FSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSV-ASLLLIT----YIL 778
            ...                 ..|.|.|                  |...| |:||.:.    :.|
Zfish   168 VHT-----------------RWGLSKP------------------LVALVHATLLAVVAVSCFFL 197

  Fly   779 LGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPF-------YVMVSMIYLMFG----LA 832
            :.:..|..:|.:|..|::||:.|||:||||.||.||...|       |.:...:||:.|    |.
Zfish   198 IPAAIFSALEENWNFLESFYFCFISLSTIGLGDYVPGEAFNQRFRELYKLGITVYLLLGLIAMLV 262

  Fly   833 LTSMFINVVQIK 844
            :...|..:.|:|
Zfish   263 VLETFCELQQLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 20/55 (36%)
Ion_trans_2 771..847 CDD:285168 29/89 (33%)
kcnk1bNP_001277277.1 Ion_trans_2 <99..157 CDD:285168 22/64 (34%)
Ion_trans_2 192..267 CDD:285168 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.