DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001028697.2 Gene:Kcnk6 / 52150 MGIID:1891291 Length:313 Species:Mus musculus


Alignment Length:348 Identity:78/348 - (22%)
Similarity:132/348 - (37%) Gaps:110/348 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRSFE 594
            |...|..|..|.||....|...|...:.|:..::...:      .|:      ..:|...|.:|.
Mouse    11 LAAYAGYLALGALLVARLERPHEARLRAELGTLREQLL------QHS------PCVAAHALDAFV 63

  Fly   595 DELNNLAELG---LRRYPG-----QKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAI 651
            :.:.....||   |....|     ..:|:|.:...|..|::||:|||:.||.|..|::.:||:|:
Mouse    64 ERVLAAGRLGRAALANASGAANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFAL 128

  Fly   652 IGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPS 716
            :|:|:.:::|                       |.|.:|:..                :....|.
Mouse   129 LGVPITMLLL-----------------------TASAQRLSL----------------LLTHAPL 154

  Fly   717 MFFS---NSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYIL 778
            .:.|   ...|:         .|||                       ::| |::..:::..:.|
Mouse   155 SWLSLHWGWPPQ---------RAAR-----------------------WHL-VALLMVIVAIFFL 186

  Fly   779 LGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV----PSNPF---YVMVSMIYLMFGLALTSM 836
            :.:..|..:|.:|:.|||||:.|||:||||.||.|    |..|:   |.::...||..||     
Mouse   187 VPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTAYLFLGL----- 246

  Fly   837 FINVVQIKLSDHFKMASAKVGAT 859
               |..:.:...|:..|...|.|
Mouse   247 ---VAMVLVLQTFRRVSDLHGLT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 19/55 (35%)
Ion_trans_2 771..847 CDD:285168 27/82 (33%)
Kcnk6NP_001028697.2 Ion_trans_2 <91..146 CDD:285168 22/77 (29%)
Ion_trans <171..253 CDD:278921 29/90 (32%)
Ion_trans_2 180..259 CDD:285168 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.