DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:435 Identity:101/435 - (23%)
Similarity:166/435 - (38%) Gaps:154/435 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 AYLICMAMLLGF----------GGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDW 582
            |:..|. ||:||          |.|:|...|...|...|.::..:|.:|:: |..|:....|   
Zfish     4 AFRSCF-MLIGFILAYFTYLLLGALVFSAIERPIEESLKADLSSLKAEFLN-LSCVNSTALE--- 63

  Fly   583 KSLARQKLRSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTI 647
             :...:.|::.:..::.|....||     .:|:..:...|..|::||:||||.||.:..|::.:|
Zfish    64 -TFLERVLKANKYGVSVLENASLR-----TNWDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSI 122

  Fly   648 VYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYY--TRSCRRIRKQQQIRSAMTGFNTMYDM 710
            |||:||:|..::||       |.||:.|   :..:.|  ..:|:|....||..:::..|      
Zfish   123 VYALIGVPFTMLVL-------TACVQRL---MHPLTYRPISACQRRAGLQQRSASVVHF------ 171

  Fly   711 AIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLIT 775
                                                                   :.:..|:::.
Zfish   172 -------------------------------------------------------IVLLFLVVLC 181

  Fly   776 YILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPS-------NPFYVMVSMIYLMFGLAL 833
            :.::.|..|..:|.:|:.|||||:.|||:.|||.||.||:       ...|.:..|:||..||.:
Zfish   182 FFVVPSLVFSAIEETWSFLDAFYFCFISLCTIGLGDFVPAEKPGQSLRALYKISVMVYLFVGLMV 246

  Fly   834 TSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHG----SRLDRIE 894
              ||:                                    .::|..:||.|:|    ..|...|
Zfish   247 --MFL------------------------------------VLRTFHKLADVYGWTAFFHLPSCE 273

  Fly   895 EDGQ------EANGNGHSPVPPLTSILRAPRPLSPASNGVDANGV 933
            ||.:      ||.....||.....||    :||.|:|. |..|.:
Zfish   274 EDEEDKEPIIEAGPEDDSPEAEKASI----KPLDPSSQ-VSYNSI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 21/55 (38%)
Ion_trans_2 771..847 CDD:285168 28/82 (34%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 27/75 (36%)
Ion_trans_2 178..254 CDD:285168 27/113 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.