DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk7

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_002728904.1 Gene:Kcnk7 / 499303 RGDID:1565025 Length:316 Species:Rattus norvegicus


Alignment Length:234 Identity:51/234 - (21%)
Similarity:84/234 - (35%) Gaps:91/234 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 SWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCV----- 672
            :|:..:..:|..:::||.|||.:.|.:..|::..:|||.:|:|..|.::|.|    .||:     
  Rat    89 NWDLPSALLFTASILTTTGYGRMAPFSSGGKAFCVVYAALGLPASLALVAAL----RRCLLPVFS 149

  Fly   673 -KFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEA 736
             ...||..|                           :.:|                   .|.|..
  Rat   150 CPGAWVAAR---------------------------WQLA-------------------PAQAAL 168

  Fly   737 ARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVF 801
            .::.|                    ..|.|:...:||...:|.|..|...:      |:|.|:.|
  Rat   169 LQAAG--------------------LGLLVACVFMLLPALVLWGIQGDCSL------LEAIYFCF 207

  Fly   802 ISMSTIGFGDLVPS-----NPFYVMVSMI----YLMFGL 831
            .|:||||.|||:|:     :|....:...    ||:.||
  Rat   208 GSLSTIGLGDLLPAQGRGLHPAIYRLGQFALLGYLLLGL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 17/55 (31%)
Ion_trans_2 771..847 CDD:285168 23/70 (33%)
Kcnk7XP_002728904.1 Ion_trans_2 <88..144 CDD:400301 18/58 (31%)
Ion_trans_2 178..>225 CDD:400301 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.