DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and CG10864

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster


Alignment Length:386 Identity:81/386 - (20%)
Similarity:150/386 - (38%) Gaps:117/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 RQLRNRCIAYLICMAMLLGFGGLLFRYTE-GAAENIYKCEVRKVKRDFID--------------- 568
            ::::..|..::..|...:|.|.|:..|.. ||...::      ::|.|:|               
  Fly    34 KRVKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMH------IERQFVDETAGHVMELRQNCSQ 92

  Fly   569 RLWDVS--HNMRE-EDWKSLARQKLRSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTI 630
            :||.::  ||:.: ..|.......||.::.::..:.:.|......::.|:|....:||.:|||.|
  Fly    93 QLWSITEQHNIIDRRRWTEATNDVLREYQSQIAGVVKHGYVGRSPEQIWSFPAALMFCLSVITMI 157

  Fly   631 GYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQ 695
            |||::.|:|..|:..|::||..|||::::...::|::..|..|||                    
  Fly   158 GYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSFKFL-------------------- 202

  Fly   696 QIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDD 760
                    :.:::|.....|.:            .:.|| ....||.:..:.             
  Fly   203 --------YRSLHDCTQEHPRL------------DRMDA-LEGGVGMTRKKV------------- 233

  Fly   761 EFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMI 825
              .:|.:....::..|:|.|:..|...| .|:.|::||:...|:..|||||.||           
  Fly   234 --IVPSTACLWVIFFYVLTGTVMFANWE-KWSLLNSFYFCMTSLCKIGFGDFVP----------- 284

  Fly   826 YLMFGLAL-TSMFINVVQIKLSD-------------------HFKMASAKVGATIGMNMTS 866
                |.:| ||..:|....||.:                   |.|:|...|...:||.:.:
  Fly   285 ----GASLTTSADVNAATQKLQEDISADPAELAQLQSVAADQHSKLAINFVYMLLGMGLVA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 21/55 (38%)
Ion_trans_2 771..847 CDD:285168 24/76 (32%)
CG10864NP_650726.1 Ion_trans_2 124..197 CDD:285168 22/72 (31%)
Ion_trans_2 242..>284 CDD:285168 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8678
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.