DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk5b

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:427 Identity:93/427 - (21%)
Similarity:140/427 - (32%) Gaps:172/427 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 LARQKLRSFEDELNNLAELGLRRYP------------------GQ----------KSWNFVNCFI 621
            |....|.|..|:..|.....|::||                  ||          .:||:.|..|
Zfish    26 LEEPNLNSAVDDYKNKTNNLLKKYPCLSKEVLGEIIEVVAEATGQGVTVTKEAQFNNWNWENAVI 90

  Fly   622 FCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTR 686
            |..|||||||||::.|||..||...|:|.:.|||:.|..:::||..|....|.|     ......
Zfish    91 FAATVITTIGYGNVAPKTTGGRLFCILYGLCGIPLCLTWISELGTFFGSRTKRL-----SQLLLH 150

  Fly   687 SCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSP 751
            |...:||.|.|                                                      
Zfish   151 SGLNVRKVQFI------------------------------------------------------ 161

  Fly   752 YPETFEVDDEFNLPVSVASLL--LITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV- 813
                          .::..||  .:.::::.:|.|:..| :||.|:..|:.|.:::|:||||.| 
Zfish   162 --------------CTIVFLLWGFLVHLIIPAFVFMFFE-NWTYLEGLYFSFTTLTTVGFGDYVA 211

  Fly   814 ---PSNPF---YVMVSMIYLMFGLALTSMFI--NVVQIKLSDHFKMASAKVGATIGMNMTSELGD 870
               ||..:   |.....:::..|||..|:|.  ||       |..:.:.||              
Zfish   212 GVDPSVNYPTLYRFFVQLWIYLGLAWLSLFFSWNV-------HMVVEAHKV-------------- 255

  Fly   871 EGGSQVKTPSELASVHGSRLDRIEEDGQEANGNGHSPVPPLTSILRAPRPLSPASNGVDANGVGA 935
                        ......|..|:..|          .||....:.:.|:| .|.|..:|.....:
Zfish   256 ------------LKKRRMRRHRLPTD----------DVPEKKEVKKTPKP-PPRSGVIDIFEFMS 297

  Fly   936 DAV-GAGDVTPPPLLPRRQVSVDPQPPAEGENKKKKK 971
            :.| ...||.       |.:..|       |.::|||
Zfish   298 EKVEDYSDVI-------RAIGAD-------EKRRKKK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 28/55 (51%)
Ion_trans_2 771..847 CDD:285168 26/86 (30%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 27/55 (49%)
Ion_trans <142..234 CDD:278921 26/165 (16%)
Ion_trans_2 171..243 CDD:285168 22/72 (31%)
C_Hendra 258..>323 CDD:293426 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.