DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCNK18

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_862823.1 Gene:KCNK18 / 338567 HGNCID:19439 Length:384 Species:Homo sapiens


Alignment Length:280 Identity:74/280 - (26%)
Similarity:129/280 - (46%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 WNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVY 678
            |:|::...||.||.:|:|||:|.|.|.:|:.|.::||:.|||:..:||.|.|.:....:...:..
Human   101 WSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNR 165

  Fly   679 VRRM-YYTRS-----CRR--IRKQQQIRSAMTGFNTMYDMAI-------------------RRPS 716
            .|:. ::||.     |.:  .:|:...:.|        |.|:                   .|||
Human   166 FRKFPFFTRPLLSKWCPKSLFKKKPDPKPA--------DEAVPQIIISAEELPGPKLGTCPSRPS 222

  Fly   717 ----MFFSNSAPENDEESQADAEAARSVGTSHPE--------TPTSPYPETFEVDDEFNLPVSVA 769
                :|..:.|.|.....|...:|... ..|.||        :..|...|..:..:..::|:.:.
Human   223 CSMELFERSHALEKQNTLQLPPQAMER-SNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPII 286

  Fly   770 SLLLITYILLGSFGFLMMEPSW-TPLD---AFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFG 830
            :|::..||...:    .:.|.| |.||   |||:.|::::||||||.|..:|.:.:...||::.|
Human   287 ALIVFAYISCAA----AILPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVG 347

  Fly   831 LALTSMFINVVQIKLSDHFK 850
            :.:..:...:||.:|.|.:|
Human   348 MEIVFIAFKLVQNRLIDIYK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 24/55 (44%)
Ion_trans_2 771..847 CDD:285168 26/79 (33%)
KCNK18NP_862823.1 Ion_trans_2 <100..155 CDD:285168 24/53 (45%)
Interaction with calcineurin. /evidence=ECO:0000250 200..205 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000250 249..254 1/5 (20%)
Ion_trans_2 288..364 CDD:285168 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5602
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm41373
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8678
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.