DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and twk-2

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001350984.1 Gene:twk-2 / 188452 WormBaseID:WBGene00006657 Length:1519 Species:Caenorhabditis elegans


Alignment Length:374 Identity:94/374 - (25%)
Similarity:164/374 - (43%) Gaps:84/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 QKVKELRQLRNRCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMR 578
            |.:::..:|....|..::|:.:....|..:|...|...|:..|...||...:....|....:|..
 Worm    25 QNIRKYAKLALPHIVLVVCVCIYATIGAWIFYTLESPNEDRLKETGRKTIAEMRSNLIYKINNNE 89

  Fly   579 EEDWKSLARQKLRSFEDEL-----------NNLAELGL-------------------RRY----- 608
            :|.||....::|..:.::|           :::..:|.                   ||:     
 Worm    90 KEVWKEDIEKELMLYSEKLYKAFKEQYVRYSDVRTIGFEGRSSYEEADETGGDSERKRRHRHGNK 154

  Fly   609 ----PGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFT 669
                ..:|.|...:...|..|.:.|||||:|.|.|.:||...:::|:.|.|:.:|.:.||||..:
 Worm   155 RGDRGSEKMWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLS 219

  Fly   670 RCVKFLWVYVRRMYYTRSCRRIRK-QQQIRSAMTGFNTMYDMAIRRPSMFFSN---SAPENDEES 730
            .|.  :|:|          :.:|| ..::.||...|..:.|.        .|:   ||.:|.:.|
 Worm   220 ECT--IWLY----------KHMRKGSARLDSAWKRFRGLEDS--------ISDDLESASKNQDSS 264

  Fly   731 QADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLD 795
            ..|.:                    .:..|:..:||.:...:::.||..|...|.::| .|:.:|
 Worm   265 ILDMD--------------------MDEIDKSEVPVLMVFTIILLYIAFGGILFSILE-DWSYMD 308

  Fly   796 AFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSMFINVVQIK 844
            ||||.|||::||||||:||.|..|:.:.:|||..||::|:|.|::..|:
 Worm   309 AFYYSFISLTTIGFGDIVPENHDYIAIMLIYLGVGLSVTTMCIDLAGIQ 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 21/55 (38%)
Ion_trans_2 771..847 CDD:285168 33/74 (45%)
twk-2NP_001350984.1 Ion_trans_2 <164..220 CDD:311712 21/55 (38%)
Ion_trans_2 285..360 CDD:311712 33/74 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I6066
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.