DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and twk-30

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_492381.3 Gene:twk-30 / 185335 WormBaseID:WBGene00006682 Length:608 Species:Caenorhabditis elegans


Alignment Length:471 Identity:108/471 - (22%)
Similarity:194/471 - (41%) Gaps:108/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 YLICMAMLLG-------FGGLLFRYTEG----AAENIYKCEVRKVKRDFIDRLWDVSHNMRE--- 579
            :|....:|:|       .|.::|:..||    |.:..:..::.:..:|::|:||.|:...|:   
 Worm     4 FLSLHVLLIGSVVLYIILGAIVFQMLEGEHLDALKKDHMAKIEQNAKDYVDKLWSVAKRDRDKYK 68

  Fly   580 --EDW-KSLARQKLRSFEDELNNL--AELGLRRYPGQKS--WNFVNCFIFCWTVITTIGYGHITP 637
              ||. ||:....:..|.|.::.:  |...:|....:.|  |:|.|...|..|::|:||||::.|
 Worm    69 NVEDLIKSVKEDTVDDFNDYVDTVFYAHRAVRHGYDEDSPTWDFANSVFFTTTMLTSIGYGYVAP 133

  Fly   638 KTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKF----LWVYVRRMYYTRSCRRIRKQQQIR 698
            .|..||...::|.:||||:.|:.:|::.|..:..:.|    ||         ..|...:::::..
 Worm   134 STFGGRLFGVIYCLIGIPLTLVTVANVAKFLSETIFFLHYELW---------NKCLEWKRKRKGE 189

  Fly   699 SAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFN 763
            ........|:             ...||:||........|             :|          
 Worm   190 VEADPLQPMF-------------GDDENEEEILDRVRLVR-------------FP---------- 218

  Fly   764 LPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLM 828
             |::|...:.: |..:.::.....| :||.:::.|::|||:.|:||||:.|| |..:.|::.:::
 Worm   219 -PLTVFFFVFV-YGCIAAWVVRYWE-TWTYVESLYFIFISILTVGFGDIRPS-PGNIWVTLAFVV 279

  Fly   829 FGLALTSMFINVV-------------QIKLSDHF---KMASAKVGATIGMNMTSELGDEGGSQVK 877
            .|:.||:|.::||             ::|.|:.|   :.|.|:.......::.::|........|
 Worm   280 VGVILTTMCMDVVGRMYLKEIHYLGRKLKSSNPFYLLREAKARRRRAAMASLLAQLAKGMIFAHK 344

  Fly   878 TPSELASVHGSRLDRIEEDGQEANGNGHSPVPPLTSILRAPRPLSPASNGVDANGVGADAVGAGD 942
            ..:|||.....|       .:|.....|  |.|....:.|..|..|.|   |...|...|.....
 Worm   345 DYNELARKKSKR-------KKEKRRGSH--VLPNEKFMFARLPPDPPS---DCQVVSTSAYSVRL 397

  Fly   943 VTPPPLLPRRQVSVDP 958
            ...||..|      ||
 Worm   398 AWAPPFSP------DP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 22/55 (40%)
Ion_trans_2 771..847 CDD:285168 24/88 (27%)
twk-30NP_492381.3 Ion_trans_2 103..166 CDD:285168 23/62 (37%)
Ion_trans_2 224..298 CDD:285168 23/76 (30%)
FN3 379..469 CDD:238020 10/38 (26%)
FN3 475..565 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.