DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and C27F2.6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:120 Identity:25/120 - (20%)
Similarity:55/120 - (45%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 VSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFG 830
            :.::||||.:..||.|........:.:...:.|:.|:::..|.|||:||:|..:.....::.:..
 Worm    21 IFLSSLLLCSISLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLVWFSGYCLFFLIS 85

  Fly   831 LALTSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASV 885
            ..|::......|.::...|.:.:.|:     :.:..|   :.|.|::|...|..:
 Worm    86 DVLSNHIFYFFQARVRYFFHILARKI-----LLLREE---DDGFQLETTVSLQHI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168
Ion_trans_2 771..847 CDD:285168 17/75 (23%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.