DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and twk-18

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001379714.1 Gene:twk-18 / 181139 WormBaseID:WBGene00006672 Length:461 Species:Caenorhabditis elegans


Alignment Length:382 Identity:101/382 - (26%)
Similarity:164/382 - (42%) Gaps:87/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQ-KLRSF 593
            ||.:......|..:|...||..|.....|.:|.:.:.|.|      .:.:.:...:.|| :|.:.
 Worm    25 LIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRR------TVYKINQLQIKRQRRLMTA 83

  Fly   594 EDELNNLAE--------LGLRRYPGQKS--WNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIV 648
            |:|.|..|:        ||:......|.  |.|:....:|.||.||||||:|.|.||.||..||:
 Worm    84 EEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATIL 148

  Fly   649 YAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIR 713
            ||.||||:.::.|..||.||.:..|.||     .::.:|.|.:.|               |::.:
 Worm   149 YAFIGIPLTVLSLYCLGSLFAKGCKMLW-----RFFLKSTRVVSK---------------DLSNK 193

  Fly   714 RPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLIT--Y 776
                  .:.|.:|.||           ||    |..:|..|..|.:|:..|...::.|||||  :
 Worm   194 ------ISEAADNIEE-----------GT----TAITPSAEKTENNDDDLLSFPISGLLLITVIW 237

  Fly   777 ILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSMFINVV 841
            ::..:..|..:| .|....:.|:..||.:||||||::||:..::.:..:.|:.||:|.|..:.::
 Worm   238 VIFCAVLFTFLE-EWDFGTSLYFTLISFTTIGFGDILPSDYDFMPIVGVLLLIGLSLVSTVMTLI 301

  Fly   842 QIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHGSRLDRIEEDGQ 898
            |.::.            .:...|...:..|              :...|:...|||:
 Worm   302 QQQIE------------ALASGMKDNIDQE--------------YARALNEAREDGE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 30/55 (55%)
Ion_trans_2 771..847 CDD:285168 25/77 (32%)
twk-18NP_001379714.1 Ion_trans_2 <114..170 CDD:400301 30/55 (55%)
Ion_trans_2 232..306 CDD:400301 23/74 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.