DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and twk-46

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:376 Identity:87/376 - (23%)
Similarity:147/376 - (39%) Gaps:114/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 LRQLRNRCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRD-FIDRLWDVSHNMREEDW 582
            :|:...|.:..|....:.|..|.::|...|      |..|  |::|: ::|         .:..|
 Worm    20 MRESNMRILVGLGVAVVYLFVGAIVFVRIE------YPLE--KIEREAYLD---------YQNQW 67

  Fly   583 KSLARQKLRSFEDELN----NLAELGL------RRYPGQKSWNFVNCFIFCWTVITTIGYGHITP 637
            :....| |...|.|::    |:.|..|      |......:|.|...|.|..|:|:|:|||.::|
 Worm    68 RDRLIQ-LDIDESEIDKLFLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTLISTVGYGRVSP 131

  Fly   638 KTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMT 702
            :|..|:..||:|.:||||:.|.:|:.:              |.||.        ....::|..:.
 Worm   132 RTEYGKLFTILYCVIGIPLTLALLSAI--------------VARMR--------EPSHKLRGLLN 174

  Fly   703 GFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVS 767
                      :|....|:                     .:|.:.              .::.|.
 Worm   175 ----------QRLGHLFT---------------------VNHIQL--------------IHVGVV 194

  Fly   768 VASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNP-------FYVMVSMI 825
            .|||||..: .:.::.|..:|..|:.||||||.|:|::|||.||..|.:.       .|.:.:.:
 Worm   195 FASLLLFVF-AIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEPGDDPNQSFRGLYKIGATV 258

  Fly   826 YLMFGLALTSMFI----NVVQIKLSDHFKMASAKVGATIGMNMTSELGDEG 872
            |||.||....:|:    ::.|..|:..|..:..:      |..:.|.|..|
 Worm   259 YLMGGLCCMMLFLATLYDIPQFNLTSFFVKSDEE------MRFSEEDGKYG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 22/55 (40%)
Ion_trans_2 771..847 CDD:285168 29/86 (34%)
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 25/78 (32%)
Ion_trans_2 198..274 CDD:285168 27/76 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.