DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and sup-9

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:363 Identity:84/363 - (23%)
Similarity:132/363 - (36%) Gaps:128/363 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 RCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQK 589
            |.::.::|....|..|..:|...|...|.:.:..|::|:...     ...:||...|::.|....
 Worm     7 RTLSLIVCTLTYLLVGAAVFDALETENEILQRKLVQRVREKL-----KTKYNMSNADYEILEATI 66

  Fly   590 LRSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGI 654
            ::|..             :.....|.|...|.|..||||||||||.||.|..|:...::||:.||
 Worm    67 VKSVP-------------HKAGYQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLYALAGI 118

  Fly   655 PMFLIVLADLG-KLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMF 718
            |:.||:...:| ::.|...|.|          |..||...:|                       
 Worm   119 PLGLIMFQSIGERMNTFAAKLL----------RFIRRAAGKQ----------------------- 150

  Fly   719 FSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLI-------TY 776
                                                          |:..:|.|:|       ..
 Worm   151 ----------------------------------------------PIVTSSDLIIFCTGWGGLL 169

  Fly   777 ILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV--------PSNPFYVMVSMIYLMFGLAL 833
            |..|:|.|...| :||..||.||.|::::||||||.|        .:.|.||..|:::::|||.:
 Worm   170 IFGGAFMFSSYE-NWTYFDAVYYCFVTLTTIGFGDYVALQKRGSLQTQPEYVFFSLVFILFGLTV 233

  Fly   834 TSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDE 871
            .|..:|::.::.              :.||...|..||
 Worm   234 ISAAMNLLVLRF--------------LTMNTEDERRDE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 26/56 (46%)
Ion_trans_2 771..847 CDD:285168 30/90 (33%)
sup-9NP_494333.1 Ion_trans_2 <77..132 CDD:311712 26/54 (48%)
Ion_trans_2 168..242 CDD:311712 28/74 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.