DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk7

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:438 Identity:91/438 - (20%)
Similarity:156/438 - (35%) Gaps:130/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLL--GFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHN--MREEDWKSLARQKL 590
            |:.||.||  |.|.::.:..||......:.:|:.....|     ...|.  :..|..:.|....|
Mouse    12 LLLMAHLLAMGLGAVVLQALEGPPARHLQAQVQAELASF-----QAEHRACLPPEALEELLGAVL 71

  Fly   591 RSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIP 655
            |:   :.:.::.||  ......:|:..:..:|..:::||.||||:.|.:..|::..:|||.:|:|
Mouse    72 RA---QAHGVSSLG--NSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKAFCVVYAALGLP 131

  Fly   656 MFLIVLADLG----KLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPS 716
            ..|.::|.|.    .:|:|...  ||.:|                           :.:|     
Mouse   132 ASLALVAALRHCLLPVFSRPGD--WVAIR---------------------------WQLA----- 162

  Fly   717 MFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGS 781
                          .|.|...::.|                    ..|.|:...:||...:|.|.
Mouse   163 --------------PAQAALLQAAG--------------------LGLLVACVFMLLPALVLWGV 193

  Fly   782 FGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSMFINVVQIKLS 846
            .|...:      |:|.|:.|.|:||||.|||:|::             |..|.....::.|..|.
Mouse   194 QGDCSL------LEAIYFCFGSLSTIGLGDLLPAH-------------GRGLHPAIYHLGQFALL 239

  Fly   847 DHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHGSRLDRIEEDG-------------Q 898
            .:..:  ..:...:.:...|||     .||:...:.....|||.|. ::||             .
Mouse   240 GYLLL--GLLAMLLAVETFSEL-----PQVRAMVKFFGPSGSRTDE-DQDGILGQDELALSTVLP 296

  Fly   899 EANGNGHSPVPPLTSILRAPRPLSPASNGVDANGVGADAVGAGDVTPP 946
            :|...|.:....::.....|:|..|:    .|.|...|.||..:...|
Mouse   297 DAPVLGPTTPASVSEHQNRPQPADPS----QATGSQLDRVGGPEREAP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 19/59 (32%)
Ion_trans_2 771..847 CDD:285168 22/75 (29%)
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 17/50 (34%)
Ion_trans_2 178..>225 CDD:285168 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845636
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.