DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk4

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_006526779.1 Gene:Kcnk4 / 16528 MGIID:1298234 Length:444 Species:Mus musculus


Alignment Length:445 Identity:107/445 - (24%)
Similarity:174/445 - (39%) Gaps:157/445 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 RQLRNRCIAYLICMAML-LGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWK 583
            |.:|:..:..|:.:.:| |..|.|:|:    |.|..::.:.:| |.|         |. |::..:
Mouse    45 RTMRSTTLLALLALVLLYLVSGALVFQ----ALEQPHEQQAQK-KMD---------HG-RDQFLR 94

  Fly   584 SLARQKLRSFEDELNNLAE-LGLRRYP---------GQKSWNFVNCFIFCWTVITTIGYGHITPK 638
            .......:|.||.:..|.| ||....|         ...:||..:.|.|..|:|||||||:|...
Mouse    95 DHPCVSQKSLEDFIKLLVEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLH 159

  Fly   639 TGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTG 703
            |..||...|.||::|||:|.::||.:|                             .::.|    
Mouse   160 TDAGRLFCIFYALVGIPLFGMLLAGVG-----------------------------DRLGS---- 191

  Fly   704 FNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVS- 767
                   ::||                          |..|.|.          :..::::|.. 
Mouse   192 -------SLRR--------------------------GIGHIEA----------IFLKWHVPPGL 213

  Fly   768 VASLLLITYILLG--------SFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP------SNPF 818
            |.||..:.::|:|        :|.|..|| ||:.|:|.|:|.::::|:||||.||      ::|.
Mouse   214 VRSLSAVLFLLIGCLLFVLTPTFVFSYME-SWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPA 277

  Fly   819 YVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELA 883
            |..:...:::||||    :...|...:.:..:..|.:..|.:| .:|              ::.|
Mouse   278 YQPLVWFWILFGLA----YFASVLTTIGNWLRAVSRRTRAEMG-GLT--------------AQAA 323

  Fly   884 SVHGSRLDRIEEDGQEANGNGHSPVPP------LTSILRAP--------RPLSPA 924
            |..|:...|:.:      ..|.|..||      |.|.|.||        ||.|||
Mouse   324 SWTGTVTARVTQ------RTGPSAPPPEKEQPLLPSSLPAPPAVVEPAGRPGSPA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 26/55 (47%)
Ion_trans_2 771..847 CDD:285168 27/89 (30%)
Kcnk4XP_006526779.1 Ion_trans_2 <135..189 CDD:369572 26/82 (32%)
Ion_trans_2 227..305 CDD:369572 24/82 (29%)
SucB_Actino <327..>398 CDD:200219 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.