DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and Kcnk6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:349 Identity:76/349 - (21%)
Similarity:130/349 - (37%) Gaps:112/349 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRSFE 594
            |:..|..|..|.||....|...|...:.|:..::...:      .|:      ..:|...|.:|.
  Rat    11 LVAYAGYLALGALLVARLERPHEARLRAELGTLREQLL------RHS------PCVAAHALDAFV 63

  Fly   595 DELNNLAELG---LRRYPG-----QKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAI 651
            :.:.....||   |....|     ..:|:|.:...|..|::||:|||:.||.|..|::.:||:|:
  Rat    64 ERVLAAGRLGRAVLANASGPANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFAL 128

  Fly   652 IGIPMFLIVLA----DLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAI 712
            :|:|:.:::|.    .|..|.|. ....|:.:|..:                             
  Rat   129 LGVPITMLLLTASAQRLSLLLTH-APLSWLSLRWGW----------------------------- 163

  Fly   713 RRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYI 777
                                           ||:...           .::| |::..:::..:.
  Rat   164 -------------------------------HPQRAA-----------RWHL-VALLMVIVAIFF 185

  Fly   778 LLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV----PSNPF---YVMVSMIYLMFGLALTS 835
            |:.:..|..:|.:|:.|||||:.|||:||||.||.|    |..|:   |.::...||..||    
  Rat   186 LIPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRSLYKVLVTAYLFLGL---- 246

  Fly   836 MFINVVQIKLSDHFKMASAKVGAT 859
                |..:.:...|:..|...|.|
  Rat   247 ----VAMVLVLQTFRRVSDLHGLT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 21/59 (36%)
Ion_trans_2 771..847 CDD:285168 27/82 (33%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 19/54 (35%)
Ion_trans_2 180..259 CDD:400301 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.