DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk17

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_005158968.1 Gene:kcnk17 / 101882139 ZFINID:ZDB-GENE-120113-3 Length:299 Species:Danio rerio


Alignment Length:361 Identity:86/361 - (23%)
Similarity:146/361 - (40%) Gaps:99/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKR-DFIDRLWDVSHNMREEDWKSLARQKL 590
            :||::       .|||:|...||... :.:..:.|.|| :.:::...:..|...|..:.:....|
Zfish    29 VAYVL-------VGGLVFWKLEGWYV-LQQIALLKEKRLELLEKYPCLGQNGLSELAQMIKSASL 85

  Fly   591 RSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIP 655
            .....:.|:.|: ||        |.|.:..:|..||:||||||:|.|.|..|:...:::|:.|||
Zfish    86 SGLSPDSNDTAD-GL--------WKFTSSSVFAATVVTTIGYGNIVPLTTAGQIFCVMFALFGIP 141

  Fly   656 MFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFS 720
            :.::||..:||                                         |.:||.|   .|.
Zfish   142 LNVVVLNRVGK-----------------------------------------YMLAIER---HFC 162

  Fly   721 NSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFL 785
            |...:..:..:....:..|:..                       ||.|.|.|:..:||    |.
Zfish   163 NFLEKKIDRGKCVRISIHSISF-----------------------VSSAFLYLVVPMLL----FK 200

  Fly   786 MMEPSWTPLDAFYYVFISMSTIGFGDLVPS-NP------FYVMVSMIYLMFGLALTSMFIN-VVQ 842
            ..| .|:..:|.||.||::|||||||.|.. ||      :|..:..:::.||||..::.:| .:.
Zfish   201 EYE-GWSYAEAIYYCFITLSTIGFGDYVADHNPEINYPEWYSCLMAVWIFFGLAWLALLVNHTID 264

  Fly   843 IKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKT 878
            :..|.:..:...:.|.: ..|.|.|..::|..:.:|
Zfish   265 LLESLNAYLRGRQTGQS-QTNETEEKPEKGLKEEET 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 23/55 (42%)
Ion_trans_2 771..847 CDD:285168 28/83 (34%)
kcnk17XP_005158968.1 Ion_trans_2 <100..154 CDD:285168 23/94 (24%)
Ion_trans_2 189..267 CDD:285168 28/82 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.