DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCNK7

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:383 Identity:77/383 - (20%)
Similarity:136/383 - (35%) Gaps:133/383 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHN-------MREEDWKS 584
            :|:|:.    ||.|.::|:..||......:.|:|.....|     ...|.       :.|....:
Human    15 VAHLLA----LGLGAVVFQALEGPPACRLQAELRAELAAF-----QAEHRACLPPGALEELLGTA 70

  Fly   585 LARQKLRSFEDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVY 649
            ||.|        .:.::.||  .....::|:..:..:|..:::||.||||:.|.:..|::..:||
Human    71 LATQ--------AHGVSTLG--NSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVY 125

  Fly   650 AIIGIPMFLIVLADLGKLFTRCV------KFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMY 708
            |.:|:|..|.::|.|    ..|:      ...||.|.                           :
Human   126 AALGLPASLALVATL----RHCLLPVLSRPRAWVAVH---------------------------W 159

  Fly   709 DMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLL 773
            .::..|.::.            ||                                 |::..|:.
Human   160 QLSPARAALL------------QA---------------------------------VALGLLVA 179

  Fly   774 ITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPS-----NPFYVMVSMI----YLMF 829
            .:::||.:.....::...:.|.|.|:.|.|:||||..||:|.     :|....:..:    ||:.
Human   180 SSFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALLGYLLL 244

  Fly   830 G----LALTSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELA 883
            |    |.....|..:.|::....|...|..|        |:|  |:||  :....|||
Human   245 GLLAMLLAVETFSELPQVRAMGKFFRPSGPV--------TAE--DQGG--ILGQDELA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 18/55 (33%)
Ion_trans_2 771..847 CDD:285168 22/88 (25%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 17/49 (35%)
Ion_trans_2 182..>220 CDD:285168 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.