DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk2

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:366 Identity:84/366 - (22%)
Similarity:141/366 - (38%) Gaps:119/366 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 YLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSH---NMREEDWKSLARQKL 590
            :|:.:..|: .|..:|:..|...|:..:..:...|.:||     ::|   |:.|.|  .|.:|.:
 Frog    52 FLVVVLYLI-IGATVFKALEQPHESAQRTTIVIQKNNFI-----LNHSCVNVTELD--ELIQQLM 108

  Fly   591 RSFEDELNNLAELGLRRYPGQKS-WNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGI 654
            .:.     |...:.:.....|.| |:..:.|.|..|||||||:|:|:|:|..|:...|:||::||
 Frog   109 AAI-----NAGIIPIGNTSHQNSHWDLGSSFFFAGTVITTIGFGNISPRTKGGKIFCIIYALLGI 168

  Fly   655 PMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFF 719
            |:|..:||.:|                             .|:       .|::...|.|....|
 Frog   169 PLFGFLLAGVG-----------------------------DQL-------GTIFGKGIARVEDMF 197

  Fly   720 SNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGF 784
                    |:........|.:.|                               :.:||.|...|
 Frog   198 --------EKWNVSQTKIRIIST-------------------------------VIFILFGCILF 223

  Fly   785 LMME-------PSWTPLDAFYYVFISMSTIGFGDLVPSN------PFYVMVSMIYLMFGLALTSM 836
            :.:.       ..|..|||||:|.|:::||||||.|...      .||..|...:::.|||..:.
 Frog   224 VAIPAVIFQHIEDWHTLDAFYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAA 288

  Fly   837 FINVVQIKLSDHFKMASAKVGATIG----------MNMTSE 867
            .::::    ||..::.|.|....:|          .|:|:|
 Frog   289 VLSMI----SDWLRVISRKTKEEVGEFRAHAAEWTANVTAE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 25/55 (45%)
Ion_trans_2 771..847 CDD:285168 25/88 (28%)
kcnk2XP_031758740.1 Ion_trans_2 <128..182 CDD:400301 25/82 (30%)
Ion_trans_2 220..298 CDD:400301 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.