DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk2

DIOPT Version :10

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:81 Identity:17/81 - (20%)
Similarity:33/81 - (40%) Gaps:11/81 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   886 EHMRKFTLRMVLFLLLFLDTAKRRKLIKHNPCLFVRNAPHKETKEILIRFASQLVSGIGDITKH- 949
            |..|.||:..|:.:...|.:.....::|     .:|:|.......:...|...:::.||.|..| 
 Frog    68 ERGRCFTIEYVMPMNTQLTSESTVNVLK-----MIRSATPFPLVSLFFMFIGFILNNIGHIRPHR 127

  Fly   950 -----MKRVGYVLSHK 960
                 :..:.::||.|
 Frog   128 TILAFVSGIFFILSGK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 Caldesmon <64..>243 CDD:460421
Ion_trans_2 <613..670 CDD:462301
Ion_trans_2 771..847 CDD:462301
kcnk2XP_031758740.1 Ion_trans_2 <124..182 CDD:462301 4/20 (20%)
Ion_trans_2 220..298 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.