DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk18

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_031761959.1 Gene:kcnk18 / 100486306 XenbaseID:XB-GENE-6257492 Length:429 Species:Xenopus tropicalis


Alignment Length:444 Identity:106/444 - (23%)
Similarity:188/444 - (42%) Gaps:111/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 WKRLK---LDYPQKVKELRQLRNRCIAYLICMAMLLG-FGGLLFRYTEGAAENIYKCEVRKVKRD 565
            ||.|:   :.:|.             ..|:|..:|.. .|.|:|.:.||:.|.    |:.:.: :
 Frog    35 WKCLQAFWISFPH-------------VCLVCSLVLYSILGALMFWFIEGSREK----EISQFE-E 81

  Fly   566 FIDRLWDVSHN------------MREEDWKSLARQKLRSFEDELNNLAELGLRRYPGQKSWNFVN 618
            |:::||.:..|            ...|.:|.|||:.:      :.:|....|::  .::.|:|.:
 Frog    82 FLEKLWMIVQNSSIDNATISDNGSAPEIFKELAREAI------ITDLQVEWLQK--PEEQWSFKS 138

  Fly   619 CFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMY 683
            ...||.||.||:|||||.|.|..|:...:|||.:|||:.|::|||||.:..|.:.  ..|.|.:.
 Frog   139 SLFFCCTVFTTVGYGHICPVTMYGKLACMVYATLGIPLMLLLLADLGDILARLLS--RTYKRAVL 201

  Fly   684 YTRSCRRI------RKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEE---SQADAE---- 735
               :|.::      .|...:....:|.:::......|.||    ..|.|..|   :||..:    
 Frog   202 ---ACNKLCHKPKPIKLSSLHKEHSGKSSLLKTMDSRVSM----KEPLNITEVIKTQASVKRKYL 259

  Fly   736 ------------------------AARSVGTSHPE----TPTSPYPETF----EVDDEFNLPVSV 768
                                    :.:....|.|:    .|:....:.|    |..|..::|:.:
 Frog   260 QMRNIDIFELIIVKENQKVLPLKSSLQQKSFSCPDLDLWPPSDSAMQNFDKIGEELDHLDVPIVL 324

  Fly   769 ASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLAL 833
            ..|:::.||:.|:....:.|..||.:||||:.|::::||||||::|.:|.|.::...|.:.|:.:
 Frog   325 IVLVMVAYIMCGACILPLWEDDWTTIDAFYFCFVTLTTIGFGDIIPKHPNYFLLLSAYTVVGMVI 389

  Fly   834 TSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHG 887
            ..|...:.|.:|...:|.....:               .|..:|..|:...|.|
 Frog   390 VCMAFKLGQNRLVSFYKQCILCI---------------SGGNIKKYSKTEDVSG 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 28/55 (51%)
Ion_trans_2 771..847 CDD:285168 26/75 (35%)
kcnk18XP_031761959.1 Ion_trans_2 <131..>175 CDD:400301 20/43 (47%)
Ion_trans_2 327..402 CDD:400301 25/74 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.