DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and XB5727110

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_031747981.1 Gene:XB5727110 / 100486031 XenbaseID:XB-GENE-5727111 Length:318 Species:Xenopus tropicalis


Alignment Length:405 Identity:92/405 - (22%)
Similarity:153/405 - (37%) Gaps:133/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAML--LGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRS 592
            |:.||.:  |..|.|:|:..|..||:..|.:..:.:.||:            :::..|.::.|..
 Frog    11 LLAMAFMVYLLVGALVFQVLEKEAEDTAKTDTERHRLDFL------------KNYTCLTKEALDH 63

  Fly   593 FEDELNNLAELGLRRYPGQ-----KSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAII 652
            ..:.:.:..:.|:.....|     .:|:..:.|.|..||:||||||.::|:|..|:...::||:.
 Frog    64 LVNVITDAVKQGIHPLENQTKNSHSNWDMSSSFFFAGTVVTTIGYGTLSPRTPGGQIFCVLYALF 128

  Fly   653 GIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSM 717
            |||:.:|||..:||:.:|.                |.|:                        ..
 Frog   129 GIPLNVIVLGRVGKILSRV----------------CHRL------------------------GQ 153

  Fly   718 FFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSF 782
            :|.|...:                                       |.....|.:|.:.:.|..
 Frog   154 YFFNKGMK---------------------------------------PKKAKVLTIIFFSVTGII 179

  Fly   783 GFLMMEP-------SWTPLDAFYYVFISMSTIGFGDLV---------PSNPFYVMVSMIYLMFGL 831
            .||.:.|       .||..:..||.|||:|||||||.|         |...|..:| .::::|||
 Frog   180 VFLGLPPLLFTKTEKWTYTEGVYYAFISLSTIGFGDYVVGYGPQHFMPFRGFRALV-CLWIIFGL 243

  Fly   832 ALTSMFINVVQIKLSD---------HFKMASAKVGATIGMN-MTSELGDEGGSQVKTPSELASVH 886
            :..|:..|::...|.|         ..|:.|.|....|.:. :||....|  |:....|...::.
 Frog   244 SWLSLLFNLLTSLLEDTEKKIAKDIQKKVKSKKDSEQIALEPLTSSYLSE--SEKTVDSNNCNIP 306

  Fly   887 GSRLDRIEEDGQEAN 901
            |      |:.|:.||
 Frog   307 G------EQSGKMAN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 24/55 (44%)
Ion_trans_2 771..847 CDD:285168 30/91 (33%)
XB5727110XP_031747981.1 Ion_trans_2 86..146 CDD:400301 24/59 (41%)
Ion_trans_2 178..245 CDD:400301 24/67 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.