DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001120420.1 Gene:kcnk6 / 100145504 XenbaseID:XB-GENE-958681 Length:308 Species:Xenopus tropicalis


Alignment Length:419 Identity:91/419 - (21%)
Similarity:152/419 - (36%) Gaps:146/419 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAML-LGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKL 590
            :..|:|..:: |..|.|:....|...|...:.|:|::|..|::....|:.:            .|
 Frog     7 LTLLVCAYVIYLLLGALVISVIESPYEASLRDELRQLKSVFLNESPCVNVS------------SL 59

  Fly   591 RSFEDELNNLAELG---LRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAII 652
            .:|.:::.|..:.|   |........|:..:...|..|::||:|||:.||.|..|::..|.||:|
 Frog    60 EAFLEKIINANKYGVSVLHNASNDSKWDIASSMFFASTLVTTVGYGYTTPLTDSGKAFCIFYALI 124

  Fly   653 GIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSM 717
            |:|..::||:.              :|:|:....:.:.|...|..|    ||:.   ..:.:...
 Frog   125 GVPFTMLVLSS--------------FVQRLMVMFTHKPIHYLQVQR----GFDR---KMVTQLHF 168

  Fly   718 FFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSF 782
            ||                                                :..|:|:.::::.|.
 Frog   169 FF------------------------------------------------LLILVLVFFLIIPSA 185

  Fly   783 GFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPS-------NPFYVMVSMIYLMFGLALTSMFINV 840
            .|..:|.:|:.|||||:.|||:.|||.||.||.       ...|.:....||..||         
 Frog   186 IFNTIETTWSFLDAFYFCFISLCTIGLGDYVPGEQNDQWLRKLYKVSVAFYLFIGL--------- 241

  Fly   841 VQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHGSR----LDRI-EEDGQEA 900
                      ||...:                   |:|..:.|.:||..    |.|: ::|.|| 
 Frog   242 ----------MAMLLI-------------------VQTFHKAADLHGLTDIFYLPRLQDQDDQE- 276

  Fly   901 NGNGHSPVPPLTSI----LRAPRPLSPAS 925
                  |:...|..    |...|||:..|
 Frog   277 ------PILETTDYSTRDLEPKRPLASES 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 20/55 (36%)
Ion_trans_2 771..847 CDD:285168 26/82 (32%)
kcnk6NP_001120420.1 Ion_trans_2 72..141 CDD:369572 24/82 (29%)
Ion_trans_2 <193..251 CDD:369572 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.