DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and kcnk7

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001116288.1 Gene:kcnk7 / 100144289 XenbaseID:XB-GENE-5731928 Length:322 Species:Xenopus tropicalis


Alignment Length:325 Identity:71/325 - (21%)
Similarity:124/325 - (38%) Gaps:94/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKL--RS 592
            |:..::.|..|..:|...|...|...:.||..:..:|:.:...:|..:.::    ..|:.|  :|
 Frog    13 LLSYSLFLLLGAFVFSTLEQPQEERLRREVETMWSEFLAKHPCLSEVLLDD----FIRKALLVKS 73

  Fly   593 FEDELN---NLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGI 654
            |...::   ::.||         .|:|::...|..|.:|||||||..|.:..|::..:||||.||
 Frog    74 FGVSVHRNISIHEL---------KWDFISSLFFTGTTLTTIGYGHPFPISLGGKAFCLVYAIFGI 129

  Fly   655 PMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFF 719
            |:.|.||:              :.||.:......:.|.|.|:            ..:|.|..:  
 Frog   130 PLTLSVLS--------------IIVRNLLILLWDKPINKLQR------------QCSISRKKL-- 166

  Fly   720 SNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGF 784
                                                     |:.|.........:.:..:.:..|
 Frog   167 -----------------------------------------EWILASIFIFFTALIFFFIPAIVF 190

  Fly   785 LMMEPSWTPLDAFYYVFISMSTIGFGDLVPSN-------PFYVMVSMIYLMFGLALTSMFINVVQ 842
            ..:|.:|..:||.|:.|||:||||.||.||..       ..|.::.:.||:.||....:.:.|::
 Frog   191 NAIEENWGYVDALYFCFISLSTIGLGDYVPGERNEQRLPVLYKLLVICYLLIGLVAVFLVVEVIK 255

  Fly   843  842
             Frog   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 23/55 (42%)
Ion_trans_2 771..847 CDD:285168 23/79 (29%)
kcnk7NP_001116288.1 Ion_trans_2 <88..141 CDD:285168 23/66 (35%)
Ion_trans_2 178..254 CDD:285168 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.