DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and AgaP_AGAP006102

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_001688783.1 Gene:AgaP_AGAP006102 / 5667303 VectorBaseID:AGAP006102 Length:144 Species:Anopheles gambiae


Alignment Length:136 Identity:59/136 - (43%)
Similarity:83/136 - (61%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 WVP-AANGEVPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEV 221
            |:| :.:|..||:.:.||.|| ..|:::.||.|.|||:|.|:.|.....|||:||.|......||
Mosquito     5 WIPTSVHGPYPPHMVPGGVDSDGAQIFVGRAHHAGDLLPAKVIPDKTAAYVAYGGQETLVEHVEV 69

  Fly   222 LCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELA 286
            |......|....||.:|..|:..|.|::||.|::|||.|:|:.|:||||.||.|.||||||.|::
Mosquito    70 LVHKQLIWDTASAGQVPLGAVVGGHTSDGEILYVGRAYHEGSQTIGKVQCSHNCIYIPYGGAEVS 134

  Fly   287 YKEFEI 292
            ...:|:
Mosquito   135 VPTYEV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 28/67 (42%)
DUF3421 180..286 CDD:288732 49/105 (47%)
DM9 226..296 CDD:128937 31/67 (46%)
AgaP_AGAP006102XP_001688783.1 DM9 4..71 CDD:128937 27/65 (42%)
DUF3421 24..134 CDD:288732 51/109 (47%)
DM9 77..142 CDD:128937 31/64 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.