DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG31086

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:135 Identity:56/135 - (41%)
Similarity:81/135 - (60%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 WVPAANGEVPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVL 222
            |:..:||.:|..|:..|.|| .:.::|.||.:..|::|.|:.|:.|..|||:...|.....||||
  Fly     6 WLHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEVL 70

  Fly   223 CAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAY 287
            .....:|||.:.|.:||.|:..|:..:||.|:.||..|.|::|||||.|||||.||||..||:..
  Fly    71 SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKI 135

  Fly   288 KEFEI 292
            ..:|:
  Fly   136 FAYEV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 24/66 (36%)
DUF3421 180..286 CDD:288732 47/105 (45%)
DM9 226..296 CDD:128937 32/67 (48%)
CG31086NP_001247312.1 DM9 3..73 CDD:128937 24/66 (36%)
DUF3421 24..134 CDD:288732 49/109 (45%)
DM9 74..143 CDD:128937 32/67 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.