DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG5506

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:132 Identity:36/132 - (27%)
Similarity:57/132 - (43%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAG---GG 227
            :|.||:.||||. ....|:.|.::...::|.::....|..|............|::|.|.   ..
  Fly    37 IPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDILVAERDVNY 101

  Fly   228 QWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGK-VQPSHGCCYIPYGGEELAYKEFE 291
            .|:....|.....|:..|.|.:.|.:|..||..||.|.:|. :..|...|.|.:  |.||.::|:
  Fly   102 VWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSSQKVCIIKH--ESLALRKFD 164

  Fly   292 IY 293
            .|
  Fly   165 KY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 14/58 (24%)
DUF3421 180..286 CDD:288732 25/109 (23%)
DM9 226..296 CDD:128937 21/69 (30%)
CG5506NP_649021.1 DM9 25..96 CDD:128937 14/58 (24%)
DUF3421 47..161 CDD:288732 28/115 (24%)
DM9 100..172 CDD:128937 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.