DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG10916

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:67/153 - (43%) Gaps:22/153 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 WVP-------AANGEVPP-NALE-GGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEH 214
            |||       ..:..:|| .|:: |..:.....|:||..:..||:|....|.....:     |.|
  Fly   107 WVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAF-----GSH 166

  Fly   215 G--------HAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQP 271
            .        ..|..||.....:|:|...|..|.:||..|.:..||..:.||..:.|.:.:|||.|
  Fly   167 SCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHP 231

  Fly   272 SHGCCYIPYGGEELAYKEFEIYV 294
            ||...|||:.|:|::...:|:.|
  Fly   232 SHKVMYIPHHGQEVSVNTYEVLV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 19/82 (23%)
DUF3421 180..286 CDD:288732 35/113 (31%)
DM9 226..296 CDD:128937 25/69 (36%)
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 18/80 (23%)
DUF3421 133..246 CDD:288732 35/117 (30%)
DM9 186..254 CDD:128937 24/67 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.