DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG13321

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster


Alignment Length:140 Identity:62/140 - (44%)
Similarity:89/140 - (63%) Gaps:1/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PGCWVPAANGEVPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEY 219
            |..|:.::...:.|..:.||.|: .:|:|:.||.|||||:|.|:.|:.|..||.:||||....:|
  Fly   145 PETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDY 209

  Fly   220 EVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEE 284
            |:|...|..|:....||:|.||:..|.|::|||||||||.|.|::|.||:..||.|.|||:.|||
  Fly   210 ELLAGYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEE 274

  Fly   285 LAYKEFEIYV 294
            :....:|:.|
  Fly   275 VRIDHYEVLV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 28/69 (41%)
DUF3421 180..286 CDD:288732 54/105 (51%)
DM9 226..296 CDD:128937 34/69 (49%)
CG13321NP_001286367.1 DM9 3..73 CDD:128937
DUF3421 25..135 CDD:288732
DM9 75..143 CDD:128937
DM9 147..215 CDD:128937 27/67 (40%)
DUF3421 166..276 CDD:288732 55/109 (50%)
DM9 216..286 CDD:128937 34/69 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.