DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG44251

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster


Alignment Length:318 Identity:93/318 - (29%)
Similarity:131/318 - (41%) Gaps:82/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIEVNTPDKLEYQFFPASGGVFTFKVRSPKDAHLALTPAPEENGPIFEIFLGGWENTKSVIRKDR 66
            |....|||.:     |..|||..  :.||       ||.|...|               |:...|
  Fly   203 PAYTPTPDPM-----PPVGGVMV--MPSP-------TPPPPAGG---------------VLVMPR 238

  Fly    67 QKP---------------------EVAEVPTPGILDAGEFRGFWVRWYDNVITVGREGDAAAFLS 110
            ..|                     |||  |.|..:.| |....      :|........|:.:..
  Fly   239 PPPPPPPAGGVLVMPPPPPSFTPAEVA--PPPSFVPA-EVTAV------SVPVAPSFTPASTYNP 294

  Fly   111 YDAGSLFPVNFVGICTGWGASGTWLIDEPAPSA-PVMGFAAPTGSGPGCWVPAANG-EVPPNALE 173
            |:||          |:.:..:     :..|||| ...|:    |:....||.|..| ...|:|:.
  Fly   295 YEAG----------CSSYTPA-----ECAAPSAYDAYGY----GNNYDVWVSAEPGYYYSPDAVI 340

  Fly   174 GGFDSS-EQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGG-QWLPVDAGN 236
            ||.||: |||.:.||.:.|..:|||..||.|..|:|.||.|.....|::|...|. .|:|...||
  Fly   341 GGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVGKGKYHWVPSYGGN 405

  Fly   237 IPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV 294
            :||.|:.||.|..|.||:|||..:.|::|.|.::..:.|..||:||:|:....:|:.|
  Fly   406 VPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLSNYEVLV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052 20/118 (17%)
DM9 156..225 CDD:128937 29/70 (41%)
DUF3421 180..286 CDD:288732 45/106 (42%)
DM9 226..296 CDD:128937 28/70 (40%)
CG44251NP_725246.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..144 CDD:128937
DM9 322..393 CDD:128937 29/70 (41%)
DUF3421 344..455 CDD:288732 47/110 (43%)
DM9 396..464 CDD:128937 27/68 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.