DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG32633

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001259517.1 Gene:CG32633 / 326225 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster


Alignment Length:234 Identity:80/234 - (34%)
Similarity:111/234 - (47%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EVAEVPTPGILDAGEFRGFWVRWYDNVITVGREGDAA---AFLSYDAGSL-----FPVNFVGICT 126
            |..||| ||                 .:.|||..|..   |...|.||||     .|        
  Fly    81 ENGEVP-PG-----------------AVKVGRNVDGEYLYAGRGYHAGSLTMGKVHP-------- 119

  Fly   127 GWGASGTWLIDEPAPSAPVMGFAAPTGSGPGCWVPAANGEVPPNALEGGFDSS-EQLYIARARHE 190
               :.|...|  |..|..|..||......|..|:......:|..||..|.||: :.:|:.|....
  Fly   120 ---SHGCLYI--PYDSDEVKIFAYEVLC
QPERWIDTTATNIPDGALVAGHDSNGDTIYVGRVFRN 179

  Fly   191 GDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFI 255
            |||:|.|:.|:.|..|.|:...||...:.:||...|.:|:|...||:.|.||.:|...:||||::
  Fly   180 GDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLTGSGFRWVPASHGNVAPGALSSGPNVDGEPLYV 244

  Fly   256 GRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV 294
            |||.:..:::|||:.|||||.|||:||||:..:.:|:.|
  Fly   245 GRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLENYEVLV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052 17/70 (24%)
DM9 156..225 CDD:128937 23/69 (33%)
DUF3421 180..286 CDD:288732 46/105 (44%)
DM9 226..296 CDD:128937 33/69 (48%)
CG32633NP_001259517.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732 21/83 (25%)
DM9 74..142 CDD:128937 24/91 (26%)
DUF3421 165..275 CDD:288732 48/109 (44%)
DM9 215..284 CDD:128937 33/69 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28P3B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.