DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG44250

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:153 Identity:69/153 - (45%)
Similarity:96/153 - (62%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MGFAAPTG--SGPGCWVPAA-NGEVPPNALEGGFDSSE-QLYIARARHEGDLIPGKLHPSHGVTY 206
            ||...|.|  :....||.:: ...:||.|:.||.||.. .:|:.|:.|||:.:|.|:.||.|..|
  Fly     1 MGAVQPGGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAY 65

  Fly   207 VAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQP 271
            ||:||.||....||||...|..|:|..:|.:||||:.:|.|..||||::||..|.|::|||||.|
  Fly    66 VAYGGAEHTKTHYEVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHP 130

  Fly   272 SHGCCYIPYGGEELAYKEFEIYV 294
            ||||.|||:||:|:....:|:.:
  Fly   131 SHGCLYIPFGGQEVRINTYEVLI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 30/70 (43%)
DUF3421 180..286 CDD:288732 55/106 (52%)
DM9 226..296 CDD:128937 35/69 (51%)
CG44250NP_001163133.1 DM9 13..84 CDD:128937 30/70 (43%)
DUF3421 35..145 CDD:288732 57/109 (52%)
DM9 85..155 CDD:128937 35/69 (51%)
DM9 157..227 CDD:128937
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.