DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and LOC1276859

DIOPT Version :10

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_316259.3 Gene:LOC1276859 / 1276859 VectorBaseID:AGAMI1_013355 Length:188 Species:Anopheles gambiae


Alignment Length:161 Identity:45/161 - (27%)
Similarity:62/161 - (38%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IEVNTPDKLEYQFFPAS----------GGVFTFKVRSPKDAHLAL--TPAPEENGPIFEIFLGGW 55
            |:.|.|    ..:||.|          ..||.|.|..|.|.||..  :..|.::. :.||.||||
Mosquito    37 IDYNGP----VSYFPTSNLQHVRRTDRSKVFKFAVLGPMDGHLRFGRSQFPYDSN-VIEIVLGGW 96

  Fly    56 ENTKSVIRK------DRQKPEV-AEVPTPGILDAGEFRGFWVRWYDNVITVGR-----EGDAAAF 108
            .|:||..|:      :|....| .||.||.:|.......|.:    .|...||     :|....|
Mosquito    97 RNSKSAGRRQYRTAGNRATNNVLVEVQTPNLLSPFHPLMFVL----EVFNEGRVELRIDGQPQPF 157

  Fly   109 LSYDAGSLFPVNFVGICTGWGASGTWLIDEP 139
            |::...|..|.|::.. ..|.....:..|.|
Mosquito   158 LAFQDSSRIPANYMAF-NRWERELIYFYDCP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505 31/111 (28%)
DUF3421 177..287 CDD:463390
LOC1276859XP_316259.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.