DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and AgaP_AGAP006193

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_316258.2 Gene:AgaP_AGAP006193 / 1276858 VectorBaseID:AGAP006193 Length:214 Species:Anopheles gambiae


Alignment Length:135 Identity:29/135 - (21%)
Similarity:55/135 - (40%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ASGGVFTFKVRSPKDAHL----ALTPAPEENGPIFEIFLGGWENTKSVIRKDRQKPE-------V 71
            :|...|...:....|.|:    :..|..|   .:.|:.:.||.||:||.|:..::..       :
Mosquito    63 SSSRYFRIGIMGKNDGHIRFGRSAFPFDE---AVVELVISGWGNTQSVARRQTRRRNQSFTNVLL 124

  Fly    72 AEVPTPGILDAGEFRGFWVRWYDN-VITVGREGDAAAFLSY-DAGSLFPVNFVGICTGWGASGTW 134
            .|..||.:|.......|.:..:|| .:.:.::|:...|..| |:.:..|.:::.. ..|.....:
Mosquito   125 KEASTPRLLHKSRPLVFQLEVFDNGRVQLTKDGERRPFFEYSDSENAIPPDYMAF-VKWDVDLVY 188

  Fly   135 LIDEP 139
            ..|.|
Mosquito   189 FYDCP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052 23/110 (21%)
DM9 156..225 CDD:128937
DUF3421 180..286 CDD:288732
DM9 226..296 CDD:128937
AgaP_AGAP006193XP_316258.2 Methyltransf_FA 80..187 CDD:289052 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.