DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and AgaP_AGAP006103

DIOPT Version :9

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_001688784.1 Gene:AgaP_AGAP006103 / 1276775 VectorBaseID:AGAP006103 Length:206 Species:Anopheles gambiae


Alignment Length:155 Identity:64/155 - (41%)
Similarity:92/155 - (59%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 APSAPVMGFAAPTGSGPGCWVPA-ANGEVPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSH 202
            ||.:.:.|     ||...||... .||..|||.:..|.|| .|.:|:.||.||||::|.|:.|:.
Mosquito    53 APCSALSG-----GSESSCWQHCNVNGPFPPNMVRAGVDSDGEVIYVGRAFHEGDMVPAKVIPTK 112

  Fly   203 GVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVG 267
            .|.:|..||.|....::|||..|...|.....|::|..|:..|:|.:||||::|||.:.|:.|.|
Mosquito   113 NVAFVCHGGEEVLKEDFEVLRYGAFVWEYSSNGSVPETAMRIGQTMDGEPLYMGRAIYSGSQTPG 177

  Fly   268 KVQPSHGCCYIPYGGEELAYKEFEI 292
            ||.|||||||:|:.|.|::..::|:
Mosquito   178 KVHPSHGCCYLPFDGAEVSVTDYEV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052
DM9 156..225 CDD:128937 29/70 (41%)
DUF3421 180..286 CDD:288732 48/105 (46%)
DM9 226..296 CDD:128937 29/67 (43%)
AgaP_AGAP006103XP_001688784.1 DM9 66..132 CDD:128937 27/65 (42%)
DUF3421 86..196 CDD:288732 50/109 (46%)
DM9 137..204 CDD:128937 29/66 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.