DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and LOC1275497

DIOPT Version :10

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_314745.3 Gene:LOC1275497 / 1275497 VectorBaseID:AGAMI1_003527 Length:206 Species:Anopheles gambiae


Alignment Length:108 Identity:32/108 - (29%)
Similarity:47/108 - (43%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDAH--LALTPAPEENGPIFEIFLGGWENTKSVIRKDRQ----KPE---VAEVPTPGILDAGEFR 86
            :.||  ...|..|.:| .:.||.|||..||.|..|:..:    :|:   :.|..||.||......
Mosquito    72 QSAHTRFGATLYPYDN-DVIEIVLGGLGNTWSAGRRQTRTAANEPKNALLGEEQTPHILSRSHPT 135

  Fly    87 GFWVRWYDN-VITVGREGDAAAFLSYDAGSLFPVNFVGICTGW 128
            ...:..:.| |:.|..:|....||::...|..||.|:.. |.|
Mosquito   136 VVVLEVFQNGVVQVTMDGQVQPFLTFADSSKIPVKFMTF-TRW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505 31/105 (30%)
DUF3421 177..287 CDD:463390
LOC1275497XP_314745.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.