DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and AT4G19800

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_193715.1 Gene:AT4G19800 / 827724 AraportID:AT4G19800 Length:398 Species:Arabidopsis thaliana


Alignment Length:340 Identity:94/340 - (27%)
Similarity:147/340 - (43%) Gaps:57/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDLGFINQA------ISLKNQNSNLKVLAV 98
            |..::||:.|.|||..:|..:.......::.||        |||      .:::.:|.::|.|..
plant    18 FPATDIDSSLFTHLFCTFADLEAESYEITIATW--------NQAPFHAFTETVQQRNPHVKTLLS 74

  Fly    99 VGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLR 163
            :||.|.....::||:.:...|.:||.|.:.:.|::||.|||||||||.    |..:..:|..||.
plant    75 IGGGNADKDAFASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYPR----NEEEMYDFGKLLE 135

  Fly   164 EIKEAFAPYGYELG-------IAVGAGESLASASYEIANIAQQVDFINVMTYDF----------- 210
            |.:.|........|       .||....:.....|.:..|:..:|:||:|.|||           
plant   136 EWRSAVEAESNSSGTTALILTAAVYYSSNYQGVPYPVLAISNSLDWINLMAYDFYGPGWSTVTGP 200

  Fly   211 ----AMASDGQTGFNAPQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRG 271
                .:.:||::|        ::.:..|...|.||.|.|||...||.::.|:|...|...|    
plant   201 PASLYLPTDGRSG--------DSGVRDWTEAGLPAKKAVLGFPYYGWAWTLADPDVNGYDA---- 253

  Fly   272 EGSAGSYTGSTGYLGYNE----ICQNNWHTVFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALS 332
             .:.|......|.:.|.:    |..|....|.|......|.|:|..|:.:|:..|:..|:.:|..
plant   254 -NTTGPAISDDGEISYRQLQTWIVDNGATKVHDDMMVGDYCYAGTTWIGYDSEKSIVTKVIYAKQ 317

  Fly   333 KGLAGAMIWSLETDD 347
            |||.|...|.:..||
plant   318 KGLLGYFSWHVGGDD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 94/340 (28%)
Glyco_18 23..346 CDD:214753 92/337 (27%)
AT4G19800NP_193715.1 GH18_plant_chitinase_class_V 4..337 CDD:119358 94/340 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.