DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and AT4G19770

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:269 Identity:77/269 - (28%)
Similarity:123/269 - (45%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAF--APYGY 174
            |:...|.|::||.|.:::.|::||||||||||||.    |..:.::|..||:|.:.|.  ..|..
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPR----NAAEMSDFAELLKEWRYAVQGEAYSS 61

  Fly   175 ELGIAVGAGESLASASYE-----IANIAQQVDFINVMTYDF---------------AMASDGQTG 219
            ||.:.:.......|::|.     :..|::.:|::|:..|||               .:.|||.:|
plant    62 ELPVLILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAALYLQSDGPSG 126

  Fly   220 FNAPQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGST-- 282
                    ::.:..|:..|.||.|.|||...||.::.|:|...:            |.|..:|  
plant   127 --------DSGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNH------------GYYVDTTGP 171

  Fly   283 -----GYLGYNE----ICQNNWHTVFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGA 338
                 |.:.|::    |..|...||.|......|.|:|..|:.:|:..|:..|:.:|..|||.|.
plant   172 AISDDGEISYSQLKTWIVDNKATTVHDNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGY 236

  Fly   339 MIWSLETDD 347
            ..|.:..||
plant   237 FSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 77/269 (29%)
Glyco_18 23..346 CDD:214753 75/266 (28%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 77/269 (29%)
Glyco_18 <1..244 CDD:214753 75/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.