DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and AT4G19740

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:231 Identity:60/231 - (25%)
Similarity:98/231 - (42%) Gaps:53/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYEL 176
            |:.:...|::||:|::::.|:.||.||||.|||||    |..:..||..||:|.:.|........
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPN----NDVEMNNFGKLLQEWRSAVEVESQRT 61

  Fly   177 GI-------AVGAGESLASASYEIANIAQQVDFINVMTYDF-AMASD----------------GQ 217
            ||       ||.......|.||.:..|.:.:|::|::.|:| .:.::                |.
plant    62 GIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTEIGPPAGLYDPSIKGPCGD 126

  Fly   218 TGFNAPQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSY---T 279
            ||           :..||..|.|..|.|.|....|.|:.|.|...:       |:..|.::   .
plant   127 TG-----------LKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKDH-------GDDVAVTHRVAV 173

  Fly   280 GSTGYLGYNE----ICQNNWHTVFDYDNAAPYAYSG 311
            .:.|.:.|::    |.:....||:|.:....|..:|
plant   174 TANGSINYDQIVKFITEYKARTVYDSEVVGFYCIAG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 60/231 (26%)
Glyco_18 23..346 CDD:214753 60/231 (26%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 54/209 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.