DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and ctbs

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001018565.1 Gene:ctbs / 553763 ZFINID:ZDB-GENE-050522-422 Length:361 Species:Danio rerio


Alignment Length:349 Identity:77/349 - (22%)
Similarity:129/349 - (36%) Gaps:80/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LCTHLS----YSFFGINDNGEIQSLDTWLDYDLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKY 109
            ||..:|    :..| :.|.||    ..|..||.             :.:..:|..|.::.....|
Zfish    28 LCQPISSQPAFEVF-VFDVGE----KAWKFYDW-------------TKVTTIAAFGQYDAELMCY 74

  Fly   110 SSMSG---------------DWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFV 159
            :...|               |...|..:|...:.|.::...||:::|.|...:.|.  .:.....
Zfish    75 AHSKGVRLVLKGDIRLPEIVDPVNRTAWIQGNVKLAKSQFMDGINIDIEQAVETGS--PEYYALT 137

  Fly   160 TLLREIKEAF---APYGYELGIAVG-AGESLASASYEIANIAQQVDFINVMTYD---------FA 211
            .|::|..|:|   .| |.::...|. :.:.:....|:...||...|.:.||:||         .|
Zfish   138 DLVKETTESFHTEIP-GSQVSFDVAWSPKCIDKRCYDYITIADSCDLLFVMSYDEQSQIWGDCIA 201

  Fly   212 MASDGQTGFNAPQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQN---------WPGA 267
            ||       |||......|.:.::|......|||:||..||..:...:.|::         :.||
Zfish   202 MA-------NAPYDQTLTAYDQYISMNIDPKKLVMGVPWYGYDYSCLNFSKDGVCTIPKVPFRGA 259

  Fly   268 PCR-GEGSAGSYTGSTGYLGYNEICQNNWHTVFDYDNAAPYAYSGD-----QWVSFDNVLSVQYK 326
            ||. ..|....|:     :...:|..:....::|.:..|||....|     ..|.:|:..|:..|
Zfish   260 PCSDASGRQIPYS-----IMMKQINSSISGRLWDEEQRAPYYNYKDTEGMVHQVWYDDPESIALK 319

  Fly   327 MDFALSKGLAGAMIWSLETDDYRG 350
            ..:.:..||.|..:|:....||.|
Zfish   320 AAYVMQHGLKGIGMWNGNLLDYNG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 77/349 (22%)
Glyco_18 23..346 CDD:214753 74/343 (22%)
ctbsNP_001018565.1 GH18_chitobiase 5..358 CDD:119354 77/349 (22%)
Glyco_18 <95..334 CDD:214753 59/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.