DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and ctbs

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001011500.1 Gene:ctbs / 497004 XenbaseID:XB-GENE-975891 Length:369 Species:Xenopus tropicalis


Alignment Length:337 Identity:71/337 - (21%)
Similarity:126/337 - (37%) Gaps:76/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 INDNGEIQSL------DTWLDYDLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSG---- 114
            |.|:.:.:.|      ..|..||.             |.:..:|:.|.::.....::...|    
 Frog    38 ITDSRDFEVLVFYTKGKNWKFYDW-------------SQVTTIALFGKYDPELLCFAHSKGARLV 89

  Fly   115 -----------DWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEA 168
                       |...|.::|...:.|.::...||::||.|....:|.  .:......|:.|..||
 Frog    90 LKGDVPLPYIVDLKNRTSWITQKVELAKSQFMDGINLDIEQSVLKGS--PEYYALTALVEETTEA 152

  Fly   169 F---APYGYELGIAVG-AGESLASASYEIANIAQQVDFINVMTYD--FAMASDGQTGFNAPQWAV 227
            |   .| |.::...|. :.:.:....|....||:..||:.||:||  ..:.::.....|:|....
 Frog   153 FHREIP-GSQVTFDVAWSPDCVDERCYNYTGIAESCDFLFVMSYDEQSQIWTECVASANSPLNKT 216

  Fly   228 ENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQN--------WPGAPCRGEGSAGSYTGSTGY 284
            .:....:........|||:||..||..:...|...|        :.||||  ..:||.      .
 Frog   217 LSGYQKFTQLDIDPKKLVMGVPWYGYDYPCLDLEDNNCTLKEVPFRGAPC--SDAAGK------Q 273

  Fly   285 LGYNEICQ--NN------WHTV-----FDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLA 336
            :.|::|.:  |:      |..|     ::|.:|....:.    |.:|:.:|:..|..:....||.
 Frog   274 IPYSKITKQVNSSLTGRLWDDVQKSPFYNYKDAKGQFHQ----VWYDDPVSISLKSAYIKKLGLR 334

  Fly   337 GAMIWSLETDDY 348
            |..:|:.:..||
 Frog   335 GIGMWNGDLLDY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 71/337 (21%)
Glyco_18 23..346 CDD:214753 69/333 (21%)
ctbsNP_001011500.1 GH18_chitobiase 9..363 CDD:119354 71/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.