DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and LOC4576330

DIOPT Version :10

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_061501459.1 Gene:LOC4576330 / 4576330 VectorBaseID:AGAMI1_010339 Length:350 Species:Anopheles gambiae


Alignment Length:42 Identity:12/42 - (28%)
Similarity:12/42 - (28%) Gaps:20/42 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PGAPCRGEGSAGSYTGSTGYLGYNEICQNNWHTVFDYDNAAP 306
            |..||.|.|                ||.||    ...||..|
Mosquito   243 PQPPCSGGG----------------ICANN----CPVDNRCP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 12/42 (29%)
LOC4576330XP_061501459.1 None

Return to query results.
Submit another query.