DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and T01C4.8

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001033501.1 Gene:T01C4.8 / 3896840 WormBaseID:WBGene00044546 Length:122 Species:Caenorhabditis elegans


Alignment Length:82 Identity:20/82 - (24%)
Similarity:28/82 - (34%) Gaps:44/82 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 MDFALSKGLAGAMIWSLETDD------------------------YR------------------ 349
            ||:|.::.|.|.|||:|:.||                        |:                  
 Worm     1 MDYATNRNLRGLMIWALDLDDDADTLLNLVSSAGLCSGGSGDKITYKCVPIDDVRWWTPENSDEN 65

  Fly   350 --GQCGETYPLLKTINR 364
              ||||::.|..||..|
 Worm    66 RQGQCGKSAPFDKTAQR 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 20/82 (24%)
Glyco_18 23..346 CDD:214753 9/18 (50%)
T01C4.8NP_001033501.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164311
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.