powered by:
Protein Alignment Cht9 and T01C4.8
DIOPT Version :9
Sequence 1: | NP_611543.3 |
Gene: | Cht9 / 37392 |
FlyBaseID: | FBgn0034582 |
Length: | 368 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033501.1 |
Gene: | T01C4.8 / 3896840 |
WormBaseID: | WBGene00044546 |
Length: | 122 |
Species: | Caenorhabditis elegans |
Alignment Length: | 82 |
Identity: | 20/82 - (24%) |
Similarity: | 28/82 - (34%) |
Gaps: | 44/82 - (53%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 MDFALSKGLAGAMIWSLETDD------------------------YR------------------ 349
||:|.::.|.|.|||:|:.|| |:
Worm 1 MDYATNRNLRGLMIWALDLDDDADTLLNLVSSAGLCSGGSGDKITYKCVPIDDVRWWTPENSDEN 65
Fly 350 --GQCGETYPLLKTINR 364
||||::.|..||..|
Worm 66 RQGQCGKSAPFDKTAQR 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164311 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.