DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and Idgf1

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster


Alignment Length:438 Identity:125/438 - (28%)
Similarity:195/438 - (44%) Gaps:90/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLALLAVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGL--CTHLSYSFFGINDNGEI 66
            :|.||:|..|:.  .|..:: ||:.:.:..|.|..|...:.:|..|  ||||.|.:.|:. :|.:
  Fly     8 ILGLLSVTSLTH--AASNLI-CYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLK-SGTL 68

  Fly    67 QSLDTWLDYDLGFINQAISLKNQNSNLKVLAVVGGWNE----GSTKY-SSMSGDWYKRQNFINSA 126
            :.....:|.|:.:.....:|:.:...||:|..|||..:    ...|| ..:..:...:||||:|:
  Fly    69 ELFSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSS 133

  Fly   127 LNLLRNHGFDGLDLDWEYPNQR--------GGNWND------------------RANFVTLLREI 165
            :.||:.:|||||||.::.|..:        |..|..                  ::.|..|:..|
  Fly   134 MILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNI 198

  Fly   166 KEAFAPYGYELGIAVGAGESLASAS----YEIANIAQQVDFINVMTYDF--AMASDGQTGFNA-- 222
            |.||......|.:.|     |.:.:    :::..:..|.|:||:..:||  .:.:..:..|.|  
  Fly   199 KNAFRSANLMLSLTV-----LPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEADFTAPI 258

  Fly   223 ---------PQWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSY 278
                     |...||..||:||....|..||.||:.:|||:::||..| ...|||...| :.|..
  Fly   259 FFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGS-GLSGAPIVHE-TCGVA 321

  Fly   279 TG------STGYLGYNEIC----QN----------NWHTVFD----YDNAA--PYAYSGD--QWV 315
            .|      :.|.|.:.|||    ||          ....|.|    |.|.|  |...:||  .|:
  Fly   322 PGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWL 386

  Fly   316 SFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQC-GETYPLLKTI 362
            |||:......|..:|..|||.|..::.|..||:||.| |:.||:|::|
  Fly   387 SFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 119/419 (28%)
Glyco_18 23..346 CDD:214753 109/400 (27%)
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 119/421 (28%)
Glyco_18 24..417 CDD:214753 109/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.