DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and CG8460

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:334 Identity:71/334 - (21%)
Similarity:124/334 - (37%) Gaps:69/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDLGFINQAISLKNQNSNLKVLAV-----V 99
            :||:.|.|.....:|..:..|...|:..::....|.|.|::........|..|.:.:.|     .
  Fly    97 YDVAKIFAKKFDIISPVWLQIVKQGDRYAVAGTHDIDAGWLTDVRRKGKQVHNQRTVKVFPRFIF 161

  Fly   100 GGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLD-WEYPNQRGGNWNDRANFVTLLR 163
            ..:.:...|.  :..|..:|....:..:...:::|||||.|: |   :|..|..:|:..:..:|:
  Fly   162 DHFTDRDIKL--LLSDAQERTKVNDVLIKCCKDNGFDGLVLEVW---SQLAGRIDDKILYTLVLQ 221

  Fly   164 EIKE----------AFAPYGYELGIAVGAGESLASASYEIANIAQQVDFINVMTYDFAMASDGQT 218
            ..||          ...|:..|.|...|        ...:..:.:.:...::|||||  :|..:.
  Fly   222 MAKELQKQQLRLILVIPPFRKETGHLFG--------EKHMDKLFKHIYAFSLMTYDF--SSVQRP 276

  Fly   219 GFNAPQWAVENAINFWLSQG-----APANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSY 278
            |.|||.:.|..|:.....:|     |...|::||:..||..:           .|..|    |..
  Fly   277 GANAPLYFVRKAVETIAPEGCADMTAKRAKILLGLNMYGNDY-----------TPDGG----GPI 326

  Fly   279 TGS---------TGYLGYNEICQNNWHTVFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKG 334
            |.|         ..:|.|:|....|:..:.:.|        |...|.:..:.|:..::..|...|
  Fly   327 TFSQYLDLVRHVKKHLTYDERDVENFFEIKNDD--------GRHIVFYPTLYSINERIKLAQELG 383

  Fly   335 LAGAMIWSL 343
             .|..||.|
  Fly   384 -TGISIWEL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 71/334 (21%)
Glyco_18 23..346 CDD:214753 71/334 (21%)
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 71/334 (21%)
Glyco_18 86..393 CDD:214753 71/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.