DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and Cht10

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:365 Identity:142/365 - (38%)
Similarity:211/365 - (57%) Gaps:24/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGIN-DNGEIQSLDTWLDYDLGFINQAISLKN 88
            ||:..||.||.|.|||...:||:.||||:.|.|..:: ||..||..|:|.|.|..|..:.::.:.
  Fly  1413 CYFTNWAWYRQGGGKFLPEDIDSDLCTHIIYGFAVLSRDNLTIQPHDSWADLDNKFYERIVAYRK 1477

  Fly    89 QNSNLKVLAVVGGWNEGS-TKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYP-----NQ 147
            :.:  ||...:||||:.: .|||.:..:...|..||.:.|:.:..:.|||||||||||     :.
  Fly  1478 KGA--KVTVAIGGWNDSAGDKYSRLVRNPEARSRFIRNVLDFIEEYNFDGLDLDWEYPVCWQVDC 1540

  Fly   148 RGGNWNDRANFVTLLREIKEAFAPYGYELGIAVGAGESLASASYEIANIAQQVDFINVMTYDFAM 212
            :.|...::..|..|:||:..||.|.|..|..||...:.:..|.||:|.::....:|:||.||:..
  Fly  1541 KKGTAEEKIGFSALVRELFYAFQPRGLILSAAVSPNKKVIDAGYEVAELSHYFSWISVMAYDYHG 1605

  Fly   213 ASDGQTGFNAPQWA---------VENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPGAP 268
            ..|.:||..||.::         ...::|:|:|.||...|||:|:..||:||.|::::::...||
  Fly  1606 QWDKKTGHVAPMYSHPEGTANFNANFSMNYWISMGADRRKLVMGIPLYGQSFSLAETTKHQLNAP 1670

  Fly   269 CRGEGSAGSYTGSTGYLGYNEIC----QNNWHTVFD-YDNAAPYAYSGDQWVSFDNVLSVQYKMD 328
            ..|.|.||..|.:.|:|.|.|||    .:.|:.|.| .....|:||.||||||||:|..:::|.:
  Fly  1671 TYGGGEAGEATRARGFLAYYEICLKIRHHRWNVVRDTKGRIGPFAYHGDQWVSFDDVPMIRHKSE 1735

  Fly   329 FALSKGLAGAMIWSLETDDYRGQCG-ETYPLLKTINRKLR 367
            :..:.||.|||||:|:.||::..|. |:|||||.|||.||
  Fly  1736 YIKAMGLGGAMIWALDLDDFKNVCECESYPLLKAINRVLR 1775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 140/362 (39%)
Glyco_18 23..346 CDD:214753 128/341 (38%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 128/341 (38%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 140/362 (39%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463773
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.