DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and Cda4

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:203 Identity:36/203 - (17%)
Similarity:70/203 - (34%) Gaps:36/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YGYELGI-AVGAGESLASASYEIANIAQQVDFINVMTYDFAMASDGQTGFNAP--------QWAV 227
            ||:|:|. ::...:.|....|| ..:.:.:....::.:...::.:...|..||        |:.|
  Fly   187 YGHEIGTESISQQQGLQDKGYE-EWVGEMIGMREILRHFANVSVNDVVGMRAPFLKPGRNTQYKV 250

  Fly   228 ENAINFWLSQGAPANKLVLGVGTYGRSFQLSDS-------SQNWPG---APCRGEGSAGSYTGST 282
            .....:..........:.:.|..|...:::|..       |:.:||   .|.......| |.|  
  Fly   251 LEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEVPLNTHYVEG-YEG-- 312

  Fly   283 GYLGYNEICQNNWHTVFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDF--------ALSKGLAGAM 339
            |:..|.:.|     .:.:.|....:.:..:.:..:.......|.|.|        .|..||...:
  Fly   313 GHCPYLDQC-----VLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQTKPLENGLHKFL 372

  Fly   340 IWSLETDD 347
            .|:||..|
  Fly   373 DWALELPD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 36/203 (18%)
Glyco_18 23..346 CDD:214753 35/200 (18%)
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 36/203 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.