DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chia.6

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:384 Identity:158/384 - (41%)
Similarity:212/384 - (55%) Gaps:40/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLLALLAVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEI 66
            |..|||......||::       ||:..|:.||...||:..||:|..|||||.|:|..||:..::
Zfish     9 GFSLALCHFGLASQLV-------CYFTNWSQYRPDVGKYMPSNVDPHLCTHLIYAFSIINNENKL 66

  Fly    67 QSLDTWLDYDLGFINQAIS-LKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLL 130
            .:.: |.|..|   .|:.: ||..|.|||.|..|||||.|:|::|||......||.||.|::..|
Zfish    67 TTYE-WNDETL---YQSFNGLKQSNPNLKTLLAVGGWNFGTTQFSSMVSTPQNRQTFIQSSITFL 127

  Fly   131 RNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELG-------IAVGAGESLAS 188
            |.|||||||||||||..||....|:..|..|.:|:.||:.......|       .||.||:....
Zfish   128 RTHGFDGLDLDWEYPGSRGSPPEDKQRFTLLCKELVEAYQAESAATGRPRLMLTAAVAAGKGNID 192

  Fly   189 ASYEIANIAQQVDFINVMTYDFAMASDGQTGFNAP------------QWAVENAINFWLSQGAPA 241
            |.||||.||:.:||||:|||||..:.:..||.|:|            .:..:.|:.:|..||||.
Zfish   193 AGYEIAEIAKYLDFINIMTYDFHGSWESVTGHNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPV 257

  Fly   242 NKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEIC----QNNWHTVFDYD 302
            .||.:|...|||:|:|| |:.:..|||..|..|||:||...|:..|.|||    |.....:  .|
Zfish   258 EKLRMGFAAYGRTFRLS-SAVSGVGAPASGAASAGTYTREAGFWSYYEICTFLKQATVQQI--VD 319

  Fly   303 NAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQ-CGET-YPLL 359
            ...|||..|.:||.|||:.|.:.|:|:...||..||.:|:|:.||:.|| ||:: |||:
Zfish   320 QKVPYATKGQEWVGFDNMESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFCGQSKYPLI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 152/363 (42%)
Glyco_18 23..346 CDD:214753 143/346 (41%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 144/354 (41%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 152/370 (41%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.